DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and st14b

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_005161261.1 Gene:st14b / 777629 ZFINID:ZDB-GENE-061103-613 Length:864 Species:Danio rerio


Alignment Length:269 Identity:96/269 - (35%)
Similarity:146/269 - (54%) Gaps:33/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 SECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDD 594
            :||.........:||||||.:..|.||||||:...     :..|.||.::|:.:|:.||.|||.|
Zfish   611 AECKCGKKPHKSSRIVGGKDSDEGEWPWQVSLHMK-----TQGHVCGASVISNSWLVTAAHCVQD 670

  Fly   595 LLISQIRIRVGEYDFSHVQEQLPYI------------ERGVAKKVVHPKYSFLTYEYDLALVKLE 647
                     ..::.:|...:...|:            :|.|.:.:.||:|...:|:.|:||::|:
Zfish   671 ---------NDQFRYSQADQWEVYLGLHNQGETSKSTQRSVLRIIPHPQYDHSSYDNDIALMELD 726

  Fly   648 QPLEFAPHVSPICLPE-TDSLLIGMNATVTGWGRLSEGG-TLPSVLQEVSVPIVSNDNCKSMFMR 710
            .|:....::.|||||: |.....|.:..:||||:|.||. .:|||||:..|.|:::..|..:.  
Zfish   727 SPVTLNQNIWPICLPDPTHYFPAGKSVWITGWGKLREGSDAVPSVLQKAEVRIINSTVCSKLM-- 789

  Fly   711 AGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRI 775
               .:.|....:|||..:||.|:||||||||:.:...:||.||||::|||.||...|.|||.||:
Zfish   790 ---DDGITPHMICAGVLSGGVDACQGDSGGPMSSIEGNGRMFLAGVVSWGDGCGRRNRPGVYTRV 851

  Fly   776 SKFTPWILE 784
            :.:..||.|
Zfish   852 TDYRSWIRE 860

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 91/252 (36%)
Tryp_SPc 544..785 CDD:238113 93/255 (36%)
st14bXP_005161261.1 SEA 92..180 CDD:279699
CUB 233..342 CDD:238001
CUB 351..457 CDD:238001
LDLa 465..497 CDD:238060
LDLa 499..533 CDD:238060
LDLa 536..570 CDD:238060
LDLa 578..613 CDD:238060 0/1 (0%)
Tryp_SPc 624..858 CDD:214473 91/252 (36%)
Tryp_SPc 625..861 CDD:238113 93/255 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576718
Domainoid 1 1.000 188 1.000 Domainoid score I3236
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.