DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Tmprss11a

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_038948511.1 Gene:Tmprss11a / 686581 RGDID:1596322 Length:387 Species:Rattus norvegicus


Alignment Length:285 Identity:101/285 - (35%)
Similarity:146/285 - (51%) Gaps:26/285 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   504 ETNEISDSSIPDAGAL-GHVKTISAARSECG---VPTLARPETRIVGGKSAAFGRWPWQVSVRRT 564
            :|:.|.:....:|.|| ..|..:..  ::||   :|.:|   .|||.|..||.|.||||||::| 
  Rat   117 KTHSILNQKTRNARALPADVSVVQV--NDCGKRAIPLIA---NRIVSGNPAAKGAWPWQVSLQR- 175

  Fly   565 SFFGFSSTHRCGGALINENWIATAGHCVDDLLISQIRIRVGEYDFSHVQEQLPYIERGVAKKVVH 629
                 ::.|:|||.||...|:.||.||    ..:....|.....|...... |.::|.|.:.::|
  Rat   176 -----NNIHQCGGTLIGNMWVVTAAHC----FRTNANPRQWTLSFGTTINP-PLMKREVRRIIMH 230

  Fly   630 PKYSFLTYEYDLALVKLEQPLEFAPHVSPICLPETDSLLIGMNATV--TGWGRLSEGGTLPSVLQ 692
            .||.....::|:|||:....:.|:..|..||||| .|.....|:||  ||:|.|..||...:.|:
  Rat   231 EKYRPPARDHDIALVQFSPRVTFSDEVRRICLPE-PSASFPPNSTVYITGFGALYYGGESQNELR 294

  Fly   693 EVSVPIVSNDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGII 757
            |..|.|:|||.||...:....   |.....|||:..|..|:|:|||||||..:.....::|.||:
  Rat   295 EARVQIISNDVCKQRHVYGNE---IKRGMFCAGFLEGIYDACRGDSGGPLVVRDDKDTWYLIGIV 356

  Fly   758 SWGIGCAEANLPGVCTRISKFTPWI 782
            |||..|.:.|.|||.|:::.:..||
  Rat   357 SWGDNCGQKNKPGVYTQVTYYRRWI 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 89/240 (37%)
Tryp_SPc 544..785 CDD:238113 90/241 (37%)
Tmprss11aXP_038948511.1 SEA 35..133 CDD:396113 4/15 (27%)
Tryp_SPc 156..384 CDD:238113 90/241 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337541
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.