DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and ST14

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens


Alignment Length:263 Identity:102/263 - (38%)
Similarity:153/263 - (58%) Gaps:21/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 ECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHC-VDD 594
            :||:.:..| :.|:|||..|..|.||||||:.     .....|.||.:||:.||:.:|.|| :||
Human   603 DCGLRSFTR-QARVVGGTDADEGEWPWQVSLH-----ALGQGHICGASLISPNWLVSAAHCYIDD 661

  Fly   595 LLI-----SQIRIRVGEYDFSHVQEQLPYIERGVAKKVV-HPKYSFLTYEYDLALVKLEQPLEFA 653
            ...     :|....:|.:|.|  |...|.::....|::: ||.::..|::||:||::||:|.|::
Human   662 RGFRYSDPTQWTAFLGLHDQS--QRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYS 724

  Fly   654 PHVSPICLPETDSLL-IGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFI 717
            ..|.|||||:...:. .|....|||||....|||...:||:..:.:::...|:::.    .|:..
Human   725 SMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLL----PQQIT 785

  Fly   718 PDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWI 782
            |.: :|.|:.:||.|||||||||||.:...|||.|.||::|||.|||:.|.|||.||:..|..||
Human   786 PRM-MCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWI 849

  Fly   783 LEH 785
            .|:
Human   850 KEN 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 96/246 (39%)
Tryp_SPc 544..785 CDD:238113 97/248 (39%)
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>171 CDD:307516
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 97/248 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143804
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40690
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.