DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and prss1

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:248 Identity:86/248 - (34%)
Similarity:134/248 - (54%) Gaps:27/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 LARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLLISQIR 601
            |...:.:||||........|:|||:.       |..|.|||:||:..|:.:|.||..    |:::
Zfish    18 LGDDDDKIVGGYECTKNGVPYQVSLN-------SGYHFCGGSLISNLWVVSAAHCYK----SRVQ 71

  Fly   602 IRVGEYDFSHVQEQLPYIERGVAKKVV-HPKYSFLTYEYDLALVKLEQPLEFAPHVSPICLPETD 665
            :|:||::....:....:|.   ::||: ||.|:..|.:.|:.|:||....:...:|..:.|| :.
Zfish    72 VRLGEHNIDVTEGTEQFIN---SEKVIRHPSYNSNTLDNDVMLIKLSSSAQINSYVKTVSLP-SS 132

  Fly   666 SLLIGMNATVTGWGRLS-EGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIFLCAGYETG 729
            ....|.:..::|||.:| .|...||.|..::.||:|:..|::.:  .|:   |.....|||:..|
Zfish   133 CASSGTSCLISGWGNMSASGSNYPSRLMCLNAPILSDSTCRNAY--PGQ---ISSNMFCAGFMEG 192

  Fly   730 GQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWI 782
            |:||||||||||:...:|     |.||:|||.|||:.|.|||..::..||.||
Zfish   193 GKDSCQGDSGGPVVCNNQ-----LQGIVSWGYGCAQRNKPGVYAKVCNFTTWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 83/240 (35%)
Tryp_SPc 544..785 CDD:238113 85/241 (35%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 83/240 (35%)
Tryp_SPc 25..243 CDD:238113 85/241 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.