DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and TMPRSS3

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:279 Identity:109/279 - (39%)
Similarity:143/279 - (51%) Gaps:35/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   518 ALGHVKTISAARSECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINE 582
            |.|||.|:..  :.||  ......:|||||..:...:||||.|::      |...|.|||::|..
Human   195 ASGHVVTLQC--TACG--HRRGYSSRIVGGNMSLLSQWPWQASLQ------FQGYHLCGGSVITP 249

  Fly   583 NWIATAGHCVDDLLISQI-RIRVGEYDF------SHVQEQLPYIERGVAKKVVHPKYSFLTYEYD 640
            .||.||.|||.||.:.:. .|:||....      ||:.|::.|          |.||.......|
Human   250 LWIITAAHCVYDLYLPKSWTIQVGLVSLLDNPAPSHLVEKIVY----------HSKYKPKRLGND 304

  Fly   641 LALVKLEQPLEFAPHVSPICLPET-DSLLIGMNATVTGWGRLSEG-GTLPSVLQEVSVPIVSNDN 703
            :||:||..||.|...:.|:|||.: ::...|.....:|||...:| |....||...:||::||..
Human   305 IALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLISNKI 369

  Fly   704 CKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFF-LAGIISWGIGCAEAN 767
            |....:..|   .|....|||||.|||.|||||||||||..  |:.|.: |.|..|:||||||.|
Human   370 CNHRDVYGG---IISPSMLCAGYLTGGVDSCQGDSGGPLVC--QERRLWKLVGATSFGIGCAEVN 429

  Fly   768 LPGVCTRISKFTPWILEHV 786
            .|||.||::.|..||.|.:
Human   430 KPGVYTRVTSFLDWIHEQM 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 99/248 (40%)
Tryp_SPc 544..785 CDD:238113 100/250 (40%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060
SRCR_2 112..210 CDD:292133 7/18 (39%)
Tryp_SPc 216..444 CDD:214473 99/248 (40%)
Tryp_SPc 217..447 CDD:238113 100/250 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143788
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.