DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and zgc:123295

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:282 Identity:108/282 - (38%)
Similarity:167/282 - (59%) Gaps:30/282 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 DSSIPDAGALGHVKTISAARSECGVPTLARP--ETRIVGGKSAAFGRWPWQVSVRRTSFFGFSST 572
            ::::...|||    .::.|.|.|.:....|.  .|:||||::|..|.||||||::..::.|    
Zfish     4 NTALTVVGAL----LVNIAGSLCQLNVCGRAPLNTKIVGGQNAGAGSWPWQVSLQSPTYGG---- 60

  Fly   573 HRCGGALINENWIATAGHCVDDLLISQIRIRVGEYDFSHVQEQL---PY-IERGVAKKVVHPKYS 633
            |.|||:|||::|:.:|.||..| .|..|.:::|      :|.|.   || |.:.|.:.:.||.|:
Zfish    61 HFCGGSLINKDWVLSAAHCFQD-SIGTIMVKLG------LQSQSGSNPYQITKTVVQVINHPNYN 118

  Fly   634 FLTYEYDLALVKLEQPLEFAPHVSPICLPET-DSLLIGMNATVTGWGRLSEGGT-LPSVLQEVSV 696
            ..:.:.|:|||||:..:.|..::.|:||... ::...|..:.|||||:||.... :|.:||||.:
Zfish   119 NPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTYAAGTLSWVTGWGKLSSAANQIPDILQEVEI 183

  Fly   697 PIVSNDNCKSMFMRAGRQEFIPDIFLCAG-YETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWG 760
            ||||:.:||    ||...| |....:||| .:.||:||||||||||:.::: ..::..:||:|:|
Zfish   184 PIVSHSDCK----RAYPGE-ITSNMICAGLLDQGGKDSCQGDSGGPMVSRN-GSQWIQSGIVSFG 242

  Fly   761 IGCAEANLPGVCTRISKFTPWI 782
            .||||...|||..|:|::..||
Zfish   243 RGCAEPGYPGVYARVSQYQDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 98/245 (40%)
Tryp_SPc 544..785 CDD:238113 100/246 (41%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 98/245 (40%)
Tryp_SPc 36..264 CDD:238113 98/244 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.