DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and CG18735

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:267 Identity:105/267 - (39%)
Similarity:152/267 - (56%) Gaps:18/267 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   526 SAARSECGVPTLARPET--RIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATA 588
            |.|:.||...:.....|  |||||:......:||.:.:   .:||   ...||.:|:|:.:..||
  Fly    63 SPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIML---MWFG---NFYCGASLVNDQYALTA 121

  Fly   589 GHCVDDLLISQIRIRVGEYD--FSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLEQPLE 651
            .|||:......|.:|:.|::  .|||:    .::|.|::.::|||||...::.|:||::..:|:.
  Fly   122 AHCVNGFYHRLITVRLLEHNRQDSHVK----IVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVR 182

  Fly   652 FAPHVSPICLPETDSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEF 716
            ....:.|:|:|.......|..|.|||||.|||||.:...||||.|||:|.:.|::  ...|..: 
  Fly   183 LGIDMHPVCMPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRN--SNYGESK- 244

  Fly   717 IPDIFLCAGY-ETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTP 780
            |.|..:|||| |.||:||||||||||:........:.||||:|||.|||:.|.|||.||:..|..
  Fly   245 ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFND 309

  Fly   781 WILEHVR 787
            ||.|:.|
  Fly   310 WIAENTR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 96/241 (40%)
Tryp_SPc 544..785 CDD:238113 97/243 (40%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 96/241 (40%)
Tryp_SPc 83..314 CDD:238113 97/243 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.