DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Prss21

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_065233.2 Gene:Prss21 / 57256 MGIID:1916698 Length:324 Species:Mus musculus


Alignment Length:320 Identity:109/320 - (34%)
Similarity:150/320 - (46%) Gaps:76/320 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 VLATSGI-----------ETNEISDSSIPD--AGALGHVKTISAARSECGVPTLARPETRIVGGK 548
            |:||:.:           |..|:.:   ||  :|..|| :||               .:|||||.
Mouse    14 VVATAAMALQSTYLQVDPEKPELQE---PDLLSGPCGH-RTI---------------PSRIVGGD 59

  Fly   549 SAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVD--------DLLISQIRIRVG 605
            .|..||||||.|:|   .:|   .|.||..|:|..|:.||.||..        .:...::..|..
Mouse    60 DAELGRWPWQGSLR---VWG---NHLCGATLLNRRWVLTAAHCFQKDNDPFDWTVQFGELTSRPS 118

  Fly   606 EYDFSHVQEQLPYIERGVAKKV-VHPKYSFLTYEYDLALVKLEQPLEFAPHVSPICLPETDSLLI 669
            .::..      .|..|...:.: :.|||| ..|..|:||:||..|:.:...:.||||        
Mouse   119 LWNLQ------AYSNRYQIEDIFLSPKYS-EQYPNDIALLKLSSPVTYNNFIQPICL-------- 168

  Fly   670 GMNAT----------VTGWGRLSEGGTLPS--VLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIFL 722
             :|:|          |||||.:.|..:|||  .||||.|.|::|..|..|:.:...:..|....:
Mouse   169 -LNSTYKFENRTDCWVTGWGAIGEDESLPSPNTLQEVQVAIINNSMCNHMYKKPDFRTNIWGDMV 232

  Fly   723 CAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWI 782
            |||...||:|:|.||||||| |..||..::..|::||||||...|.|||.|.||....||
Mouse   233 CAGTPEGGKDACFGDSGGPL-ACDQDTVWYQVGVVSWGIGCGRPNRPGVYTNISHHYNWI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 95/259 (37%)
Tryp_SPc 544..785 CDD:238113 96/260 (37%)
Prss21NP_065233.2 Tryp_SPc 54..291 CDD:214473 95/259 (37%)
Tryp_SPc 55..294 CDD:238113 96/260 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834046
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.