DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:99 Identity:39/99 - (39%)
Similarity:56/99 - (56%) Gaps:6/99 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   688 PSVLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFF 752
            |..||:..||:|.|.:|.::....     |.|..:|||...||:|:||||||||: ...|...:.
Zfish    13 PRTLQQTVVPVVINSDCNNLLGAT-----ITDNMMCAGLLQGGKDTCQGDSGGPM-VSQQCSVWV 71

  Fly   753 LAGIISWGIGCAEANLPGVCTRISKFTPWILEHV 786
            .:||||.|..|.:...|||.||:|::..||:..:
Zfish    72 QSGIISKGHDCGQPYEPGVYTRVSQYQNWIMSSI 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 37/93 (40%)
Tryp_SPc 544..785 CDD:238113 39/96 (41%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 39/95 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D291432at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.