DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and tmprss5

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:274 Identity:106/274 - (38%)
Similarity:153/274 - (55%) Gaps:21/274 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   517 GALGHVKTISAARSECGVPTLAR-PETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALI 580
            |:....|.|:....|||  |.|: |  ||:||..||.||||||||:.      :::.|.|||::|
Zfish   288 GSCSTGKVIALKCFECG--TRAKLP--RIIGGVEAALGRWPWQVSLY------YNNRHICGGSII 342

  Fly   581 NENWIATAGHCVDDLLISQIR---IRVGEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLA 642
            ...||.||.|||.:..:.|:.   :..|... |::.:...|....|.:.:.:..|:..|::.|:|
Zfish   343 TNQWIVTAAHCVHNYRLPQVPSWVVYAGIIT-SNLAKLAQYQGFAVERIIYNKNYNHRTHDNDIA 406

  Fly   643 LVKLEQPLEFAPHVSPICLPETD-SLLIGMNATVTGWGRLSEGGTL-PSVLQEVSVPIVSNDNCK 705
            ||||:.||.|:..:.|:|||:.| .|..|....::|||.......| |.||:|..||::|...|.
Zfish   407 LVKLKTPLNFSDTIRPVCLPQYDHDLPGGTQCWISGWGYTQPDDVLIPEVLKEAPVPLISTKKCN 471

  Fly   706 SMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPG 770
            |..|..|.   |....|||||..|..|:|||||||||..:.:: .:.|.|::|||.||||.|.||
Zfish   472 SSCMYNGE---ITSRMLCAGYSEGKVDACQGDSGGPLVCQDEN-VWRLVGVVSWGTGCAEPNHPG 532

  Fly   771 VCTRISKFTPWILE 784
            |.:::::|..||.:
Zfish   533 VYSKVAEFLGWIYD 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 95/243 (39%)
Tryp_SPc 544..785 CDD:238113 96/246 (39%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133 6/19 (32%)
Tryp_SPc 311..544 CDD:214473 95/243 (39%)
Tryp_SPc 312..547 CDD:238113 96/246 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576747
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25354
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.