DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and TMPRSS15

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_011527956.1 Gene:TMPRSS15 / 5651 HGNCID:9490 Length:1064 Species:Homo sapiens


Alignment Length:337 Identity:112/337 - (33%)
Similarity:171/337 - (50%) Gaps:57/337 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 STTSSKT--PTTTRPISSSSSSSSG--IVTSSQRPTQPTHRTPVLATSGIETNEISDSSIPDAGA 518
            |..|||.  ||...|....:::..|  |:|.||:..|                   ||.|     
Human   768 SGNSSKPIFPTDGGPFVKLNTAPDGHLILTPSQQCLQ-------------------DSLI----- 808

  Fly   519 LGHVKTISAARSECGVPTLARPET-RIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINE 582
                 .:......||....|:..| :||||.:|..|.|||.|.:    ::|  ....||.:|::.
Human   809 -----RLQCNHKSCGKKLAAQDITPKIVGGSNAKEGAWPWVVGL----YYG--GRLLCGASLVSS 862

  Fly   583 NWIATAGHCV--DDLLISQIRIRVGEYDFSHVQEQL---PYIERGVAKKVVHPKYSFLTYEYDLA 642
            :|:.:|.|||  .:|..|:....:|    .|::..|   ..:.|.:.:.|::|.|:....:.|:|
Human   863 DWLVSAAHCVYGRNLEPSKWTAILG----LHMKSNLTSPQTVPRLIDEIVINPHYNRRRKDNDIA 923

  Fly   643 LVKLEQPLEFAPHVSPICLPETDSLL-IGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKS 706
            ::.||..:.:..::.||||||.:.:. .|.|.::.|||.:...||..::|||..||::||:.|:.
Human   924 MMHLEFKVNYTDYIQPICLPEENQVFPPGRNCSIAGWGTVVYQGTTANILQEADVPLLSNERCQQ 988

  Fly   707 MFMRAGRQEF-IPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPG 770
            ..     .|: |.:..:|||||.||.|||||||||||..: ::.|:||||:.|:|..||..|.||
Human   989 QM-----PEYNITENMICAGYEEGGIDSCQGDSGGPLMCQ-ENNRWFLAGVTSFGYKCALPNRPG 1047

  Fly   771 VCTRISKFTPWI 782
            |..|:|:||.||
Human  1048 VYARVSRFTEWI 1059

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 90/245 (37%)
Tryp_SPc 544..785 CDD:238113 92/246 (37%)
TMPRSS15XP_011527956.1 SEA 53..195 CDD:214554
LDLa 229..263 CDD:238060
CUB 270..376 CDD:278839
MAM 387..547 CDD:214533
MAM 392..547 CDD:99706
CUB 569..676 CDD:278839
LDLa 688..722 CDD:238060
SR 723..816 CDD:214555 16/76 (21%)
Tryp_SPc 829..1059 CDD:214473 90/245 (37%)
Tryp_SPc 830..1061 CDD:238113 92/246 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.