DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and TMPRSS15

DIOPT Version :10

Sequence 1:NP_476709.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001414985.1 Gene:TMPRSS15 / 5651 HGNCID:9490 Length:1064 Species:Homo sapiens


Alignment Length:39 Identity:9/39 - (23%)
Similarity:18/39 - (46%) Gaps:2/39 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 IKILHSSRSYHAEKIVQTKSMIQGLTLQTLLPLICYCPG 254
            ::.|.::.:.||.::....:  |...|:..|.|....||
Human   198 LQALSAATAEHAARLEALDA--QACALEAELRLAAEAPG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_476709.1 Tryp_SPc 544..785 CDD:238113
TMPRSS15NP_001414985.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.