DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and tmprss9

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_021325244.1 Gene:tmprss9 / 562051 ZFINID:ZDB-GENE-050208-573 Length:788 Species:Danio rerio


Alignment Length:347 Identity:110/347 - (31%)
Similarity:164/347 - (47%) Gaps:80/347 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   479 SGIVTSSQRPTQPTHRTPVLATSGIETNEISD--SSIPDAGALGHVKTISAARSECGVPTLARPE 541
            ||||              :|..||....||.:  |..||:       |.:....||  .|...||
Zfish   163 SGIV--------------LLGASGKSFYEIGNDISKCPDS-------TFTCDNGEC--ITKPNPE 204

  Fly   542 -------------------------TRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALIN 581
                                     .|||||::...|.:|||||:|      ....|.||.:::|
Zfish   205 CDYITDCTDGSDETFCSCGTRPVMSNRIVGGENTRHGEFPWQVSLR------LRGRHTCGASIVN 263

  Fly   582 ENWIATAGHCVD--------DLLISQIRIRVGEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYE 638
            ..|:.:|.||.:        ..|:...::...|.:...|         .:...|:.|||..:|.:
Zfish   264 SRWLVSAAHCFEVENNPKDWTALVGANQVSGAEAEAFIV---------NIKSLVMSPKYDPMTTD 319

  Fly   639 YDLALVKLEQPLEFAPHVSPICLPETDSLLI-GMNATVTGWGRLSEGGT-LPSVLQEVSVPIVSN 701
            .|:.:::||.||:|:.:|.|:|:|.:..:.. |.|..|:|||.|::..| :||.||:..|.|:.:
Zfish   320 SDVTVLELETPLKFSHYVQPVCIPSSSHVFTPGQNCIVSGWGALNQYTTEVPSTLQKAIVKIIDS 384

  Fly   702 DNC-KSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAE 765
            ..| ||...|..    :....:|||:..|..|||||||||||..:...||:|||||:|||:|||:
Zfish   385 KVCNKSSVYRGA----LTQNMMCAGFLQGKVDSCQGDSGGPLACEVAAGRYFLAGIVSWGVGCAQ 445

  Fly   766 ANLPGVCTRISKFTPWILEHVR 787
            .|.|||.:|::|...||:.:.:
Zfish   446 INKPGVYSRVTKLRNWIVSYTK 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 90/249 (36%)
Tryp_SPc 544..785 CDD:238113 91/251 (36%)
tmprss9XP_021325244.1 SEA 52..146 CDD:307516
LDLa 185..220 CDD:238060 8/43 (19%)
Tryp_SPc 232..462 CDD:238113 89/248 (36%)
LDLa 510..544 CDD:238060
Tryp_SPc 557..783 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576727
Domainoid 1 1.000 188 1.000 Domainoid score I3236
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25354
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.