DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and prss8

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001016980.1 Gene:prss8 / 549734 XenbaseID:XB-GENE-5758112 Length:329 Species:Xenopus tropicalis


Alignment Length:271 Identity:95/271 - (35%)
Similarity:136/271 - (50%) Gaps:28/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   522 VKTISAARSECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIA 586
            |......||:.||      ::|||||..|:.|.:|||.|:|      :...|.||.|||:.|:|.
 Frog    14 VSHFELGRSQEGV------QSRIVGGHDASEGMFPWQASLR------YDGNHVCGAALISANFIV 66

  Fly   587 TAGHCV--DDLLIS-QIRIRVGEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLEQ 648
            ||.||.  |..|:. .:.:.|.:........||..::    :..::|.||..|...|||:..|:.
 Frog    67 TAAHCFPSDHSLVGYSVYLGVLQLGVPSSNSQLLKLK----QVTIYPSYSHDTSSGDLAVAALDS 127

  Fly   649 PLEFAPHVSPICLPETD-SLLIGMNATVTGWGRLSEGGTLPSV--LQEVSVPIVSNDNCKSMFMR 710
            |..|:..|.||.||..: ...|||...|||||.:.:|..||..  ||..:|.::....|..::..
 Frog   128 PATFSHVVQPISLPAANVQFPIGMTCQVTGWGNIQQGVNLPGAKNLQVGNVKLIGRQTCNCLYNI 192

  Fly   711 AGRQEFI----PDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGV 771
            ....:.:    ||: :|||...|..|:|||||||||.. :.:|:.:||.::|||..|...|.|||
 Frog   193 KPSADSMGSIQPDM-ICAGSAAGSVDACQGDSGGPLTC-TVNGKAYLAAVVSWGDECGAQNKPGV 255

  Fly   772 CTRISKFTPWI 782
            ...||.:..||
 Frog   256 YILISAYASWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 88/248 (35%)
Tryp_SPc 544..785 CDD:238113 89/249 (36%)
prss8NP_001016980.1 Tryp_SPc 29..266 CDD:214473 88/248 (35%)
Tryp_SPc 30..269 CDD:238113 89/249 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3276
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D291432at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.