DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and prss60.2

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:256 Identity:98/256 - (38%)
Similarity:149/256 - (58%) Gaps:21/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 CGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLL 596
            ||...|   .:|||||.:|..|.||||||::...:.|    |.|||:||:..|:.||.||:..:.
Zfish    25 CGQAPL---NSRIVGGVNAPEGSWPWQVSLQSPRYGG----HFCGGSLISSEWVLTAAHCLPGVS 82

  Fly   597 ISQIRIRVGEYDFSHVQEQLPYIE--RGVAKKVVHPKYSFLTYEYDLALVKLEQPLEFAPHVSPI 659
            .|.:.:.:|.    ..|:.:...|  |.|||.:||..|:..|.:.|:||::|...:.|..::.|:
Zfish    83 ESSLVVYLGR----RTQQGVNTHETSRNVAKIIVHSSYNSNTNDNDIALLRLSSAVTFNDYIRPV 143

  Fly   660 CLPETDSLL-IGMNATVTGWGRLSEGGTLPS--VLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIF 721
            ||...:|:. .|.::.:||||.:..|..||:  :|||..:|:|:||.|.:. :.:|.   :.:..
Zfish   144 CLAAQNSVYSAGTSSWITGWGDVQAGVNLPAPGILQETMIPVVANDRCNAQ-LGSGT---VTNNM 204

  Fly   722 LCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWI 782
            :|||...||:|:||||||||:..:... .:..|||.|||.|||:.|.|||.||:|::..||
Zfish   205 ICAGLAKGGKDTCQGDSGGPMVTRLCT-VWIQAGITSWGYGCADPNSPGVYTRVSQYQSWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 93/243 (38%)
Tryp_SPc 544..785 CDD:238113 94/244 (39%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 93/243 (38%)
Tryp_SPc 34..267 CDD:238113 94/244 (39%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.