DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and epsilonTry

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster


Alignment Length:252 Identity:80/252 - (31%)
Similarity:125/252 - (49%) Gaps:32/252 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 LARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLLISQIR 601
            |.:.:.|||||...:....|:|||::|   :|   :|.|||::.:.:.:.||.||:..:....::
  Fly    24 LPQLDGRIVGGYETSIDAHPYQVSLQR---YG---SHFCGGSIYSHDIVITAAHCLQSIEAKDLK 82

  Fly   602 IRVGEYDFSHVQEQLPYIERGVAKKVV-----HPKYSFLTYEYDLALVKLEQPLEFAPHVSPICL 661
            ||||.          .|...|.:...|     |..|:..|...|:|::::|..|.|...:..|.:
  Fly    83 IRVGS----------TYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREIRI 137

  Fly   662 PETDSLLIGMNATVTGWGRLSEGG-TLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIFLCAG 725
            .:::. ..|..|.|:|||....|| |:|..|..|.:.|:....|:|.....|::  |.|..||| 
  Fly   138 ADSNP-REGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKK--IKDTMLCA- 198

  Fly   726 YETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWI 782
             ....:|:|||||||||.:..:     |.|::|||.||.:...|||...::.|..||
  Fly   199 -YAPHKDACQGDSGGPLVSGDR-----LVGVVSWGYGCGDVRYPGVYADVAHFHEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 77/244 (32%)
Tryp_SPc 544..785 CDD:238113 78/245 (32%)
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 77/244 (32%)
Tryp_SPc 31..252 CDD:238113 78/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.