DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Tmprss11c

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001025468.1 Gene:Tmprss11c / 435845 MGIID:3521861 Length:431 Species:Mus musculus


Alignment Length:277 Identity:97/277 - (35%)
Similarity:142/277 - (51%) Gaps:23/277 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 EISDSSIPDAGALGHVKTISAARSECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSS 571
            :.||.::|.|..|        ..:.||..|:.....::.||:.|..|.||||.|:::      :|
Mouse   171 KFSDIAMPIAEDL--------LNTCCGRRTIIHRGHKVAGGQDAEEGEWPWQASLQQ------NS 221

  Fly   572 THRCGGALINENWIATAGHCVDDLLISQIRIRVGEYDFSHVQEQLPYIERGVAKKVVHPKYSFLT 636
            .||||..||:..|:.||.||    .|.....:..:..|..:..: |...|.|...::|..||:..
Mouse   222 VHRCGATLISNYWLITAAHC----FIRAANPKDWKVSFGFLLSK-PQAPRAVKNIIIHENYSYPA 281

  Fly   637 YEYDLALVKLEQPLEFAPHVSPICLPE-TDSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPIVS 700
            ::.|:|:|:|..|:.:..::...|||| |.......:..|||||.|...|..|::||:..|.|:.
Mouse   282 HDNDIAVVRLSSPVLYESNIRRACLPEATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGKVKIID 346

  Fly   701 NDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAE 765
            |..|.|.....|   .|....:|||:..|..|:|||||||||.::...|.:|||||:|||..||.
Mouse   347 NKTCNSGKAYGG---MITPGMMCAGFLKGRVDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECAL 408

  Fly   766 ANLPGVCTRISKFTPWI 782
            .|.|||.||::.:..||
Mouse   409 PNKPGVYTRVTYYRDWI 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 87/239 (36%)
Tryp_SPc 544..785 CDD:238113 89/240 (37%)
Tmprss11cNP_001025468.1 SEA 62..157 CDD:279699
Tryp_SPc 199..425 CDD:214473 87/239 (36%)
Tryp_SPc 200..428 CDD:238113 89/240 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834036
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8807
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.