DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Tmprss11c

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:254 Identity:93/254 - (36%)
Similarity:135/254 - (53%) Gaps:15/254 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 SECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDD 594
            |.||..|:.....::.||:.|..|.||||.|:::      ::.||||..||:.:|:.||.||   
  Rat   173 SGCGRRTITPGGHKVAGGQDAEEGEWPWQASLQQ------NNVHRCGATLISNSWLITAAHC--- 228

  Fly   595 LLISQIRIRVGEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLEQPLEFAPHVSPI 659
             .:.....:..:..|..:..: |..:|.|...|:|..||:..:..|:|:|:|..|:.:..::...
  Rat   229 -FVRSANPKDWKVSFGFLLSK-PQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRA 291

  Fly   660 CLPE-TDSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIFLC 723
            |||| |.......:..|||||.|...|..|::||:..|.|:.|..|.|.....|   .|....||
  Rat   292 CLPEATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGG---VITPGMLC 353

  Fly   724 AGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWI 782
            ||:..|..|:|||||||||.::...|.:|||||:|||..||..|.|||.||::.:..||
  Rat   354 AGFLEGRVDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 87/239 (36%)
Tryp_SPc 544..785 CDD:238113 89/240 (37%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 87/239 (36%)
Tryp_SPc 187..415 CDD:238113 89/240 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.