DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and CG6865

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:275 Identity:97/275 - (35%)
Similarity:140/275 - (50%) Gaps:35/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 ISAARSECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAG 589
            |:.:...|.|     ...:||||..|.....|:.||:.|      ...|.|||.:|:|.||.|||
  Fly    21 IAFSNQPCSV-----RNPKIVGGSEAERNEMPYMVSLMR------RGGHFCGGTIISERWILTAG 74

  Fly   590 HCVDD-----LLISQIRIRVGEYDFSHVQEQLPYIERGV------AKKVV-HPKYSFLTYEYDLA 642
            ||:.:     :..:||:..||.:.   ::|.|..|..|.      .|.:| ||:|.....::|:|
  Fly    75 HCICNGLQQFMKPAQIQGVVGLHS---IREYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIA 136

  Fly   643 LVKLEQPLEFAPHVSPICL--PETDSLLIGMNATVTGWGRLSEG---GTLPSVLQEVSVPIVSND 702
            |::|.||:.|:.|:.|.|:  .|....|.....||:|||...|.   .....||::.:|.|.:|:
  Fly   137 LLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDRSDVLRKATVKIWNNE 201

  Fly   703 NCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEAN 767
            .|:..:...|:...|.:..||||||.|..|||..||||||.:|..    .|.|::|.|||||...
  Fly   202 ACERSYRSLGKSNTIGETQLCAGYENGQIDSCWADSGGPLMSKEH----HLVGVVSTGIGCARPG 262

  Fly   768 LPGVCTRISKFTPWI 782
            |||:.||:||:..|:
  Fly   263 LPGIYTRVSKYVSWM 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 93/255 (36%)
Tryp_SPc 544..785 CDD:238113 94/256 (37%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 93/254 (37%)
Tryp_SPc 35..280 CDD:238113 94/256 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.