DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and TMPRSS11F

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_997290.2 Gene:TMPRSS11F / 389208 HGNCID:29994 Length:438 Species:Homo sapiens


Alignment Length:268 Identity:91/268 - (33%)
Similarity:133/268 - (49%) Gaps:34/268 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 SECGV-------PTLARPET-RIVGGKSAAF-GRWPWQVSVRRTSFFGFSSTHRCGGALINENWI 585
            |.||:       |..|...| |||.|:..|. |.||||.|::.     ..|.|:||.:||:..|:
Human   184 SRCGIRMTSSNMPLPASSSTQRIVQGRETAMEGEWPWQASLQL-----IGSGHQCGASLISNTWL 243

  Fly   586 ATAGHCV-----DDLLISQIRIRVGEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVK 645
            .||.||.     ....|:.....:..          |.::|.|.|.::|..|...|.|.|:|||:
Human   244 LTAAHCFWKNKDPTQWIATFGATITP----------PAVKRNVRKIILHENYHRETNENDIALVQ 298

  Fly   646 LEQPLEFAPHVSPICLPETDSLLIGMNAT-VTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFM 709
            |...:||:..|..:|||::...|....:. |||:|.:.:.|.:.:.|::..|..:|.|.|....:
Human   299 LSTGVEFSNIVQRVCLPDSSIKLPPKTSVFVTGFGSIVDDGPIQNTLRQARVETISTDVCNRKDV 363

  Fly   710 RAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTR 774
            ..|   .|....||||:..|..|:|:|||||||...:.| .:::.||:|||..||....|||.||
Human   364 YDG---LITPGMLCAGFMEGKIDACKGDSGGPLVYDNHD-IWYIVGIVSWGQSCALPKKPGVYTR 424

  Fly   775 ISKFTPWI 782
            ::|:..||
Human   425 VTKYRDWI 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 83/245 (34%)
Tryp_SPc 544..785 CDD:238113 84/246 (34%)
TMPRSS11FNP_997290.2 SEA 59..154 CDD:279699
Tryp_SPc 205..432 CDD:214473 83/245 (34%)
Tryp_SPc 206..435 CDD:238113 84/246 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143812
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.