DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and PRSS41

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:283 Identity:91/283 - (32%)
Similarity:140/283 - (49%) Gaps:32/283 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   517 GALGHVKTISAARSE------CGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRC 575
            |..||....:.::.|      ||...:   ...:.||..:|.||||||.|:|      ....|||
Human    41 GREGHFLCPAESQEEELLSEACGHREI---HALVAGGVESARGRWPWQASLR------LRRRHRC 96

  Fly   576 GGALINENWIATAGHCVD-DLLISQIRIRVGEYDFSHVQEQLPYIERGVAKK------VVHPKYS 633
            ||:|::..|:.:|.||.. ....|:..:::||.    .....|:..|..:.:      :|:|. :
Human    97 GGSLLSRRWVLSAAHCFQKHYYPSEWTVQLGEL----TSRPTPWNLRAYSSRYKVQDIIVNPD-A 156

  Fly   634 FLTYEYDLALVKLEQPLEFAPHVSPICL-PETDSLLIGMNATVTGWGRLSEGGT---LPSVLQEV 694
            ......|:||::|...:.:..::.|||: ..|.:.:...:..|||||.:|..||   .|..|:|.
Human   157 LGVLRNDIALLRLASSVTYNAYIQPICIESSTFNFVHRPDCWVTGWGLISPSGTPLPPPYNLREA 221

  Fly   695 SVPIVSNDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISW 759
            .|.|::|..|..:|.:...:..|.|...|||.|.|..|:|:|||||||.. .:||.::..||:||
Human   222 QVTILNNTRCNYLFEQPSSRSMIWDSMFCAGAEDGSVDTCKGDSGGPLVC-DKDGLWYQVGIVSW 285

  Fly   760 GIGCAEANLPGVCTRISKFTPWI 782
            |:.|.:.|.|||.|.||.:..||
Human   286 GMDCGQPNRPGVYTNISVYFHWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 83/249 (33%)
Tryp_SPc 544..785 CDD:238113 85/250 (34%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143815
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.