DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Prss21

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:309 Identity:102/309 - (33%)
Similarity:145/309 - (46%) Gaps:80/309 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 HVKTISAARSE----------CGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRC 575
            |||.:...:.|          ||..|:   .:|||||:.|..||||||.|:|   .:|   .|.|
  Rat    28 HVKPVDPEKPELQEANLLSGPCGHRTI---PSRIVGGEEAELGRWPWQGSLR---VWG---NHLC 83

  Fly   576 GGALINENWIATAGHCVD--------DLLISQIRIRVGEYDFSHVQEQLPYIERGVAKKV-VHPK 631
            |..|:|..|:.||.||..        .:...::..|...::..      .|..|...:.: :.||
  Rat    84 GATLLNRRWVLTAAHCFQKDNDPFDWTVQFGELTSRPSLWNLQ------AYSNRYQIEDIFLSPK 142

  Fly   632 YSFLTYEYDLALVKLEQPLEFAPHVSPICLPETDSLLIGMNAT----------VTGWGRLSEGGT 686
            |: ..:.:|:||:||..|:.::..:.||||         :|:|          |||||.:.|..:
  Rat   143 YT-EQFPHDIALLKLSSPVTYSNFIQPICL---------LNSTYKFANRTDCWVTGWGAIGEDES 197

  Fly   687 --LPSVLQEVSVPIVSNDNCKSMFMRAGRQEFIPDI-------FLCAGYETGGQDSC-------- 734
              ||:.||||.|.|::|..|..:|.:       ||.       .:|||...||:|:|        
  Rat   198 LPLPNNLQEVQVAIINNTMCNHLFKK-------PDFRINIWGDMVCAGSPEGGKDACFAKLTYAA 255

  Fly   735 -QGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWI 782
             ||||||||.. :||..::..|::||||||...|.|||.|.||....||
  Rat   256 PQGDSGGPLVC-NQDTVWYQVGVVSWGIGCGRPNRPGVYTNISHHYNWI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 93/275 (34%)
Tryp_SPc 544..785 CDD:238113 94/276 (34%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 93/275 (34%)
Tryp_SPc 58..304 CDD:238113 94/276 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.