DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and TMPRSS7

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:254 Identity:93/254 - (36%)
Similarity:131/254 - (51%) Gaps:29/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   543 RIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLLISQ---IRIRV 604
            ||:||.....|.||||||:.      |..:..||.::|:..|:.:|.||.....:|.   ....:
Human   605 RIIGGTDTLEGGWPWQVSLH------FVGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHL 663

  Fly   605 GEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLE--QPLEFAPHVSPICLPET-DS 666
            |.|    ||....::. .|.:.|||..|:..|::||:||::|.  .|......:.|||:|.| ..
Human   664 GMY----VQGNAKFVS-PVRRIVVHEYYNSQTFDYDIALLQLSIAWPETLKQLIQPICIPPTGQR 723

  Fly   667 LLIGMNATVTGWGRLSEG---GTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIFLCAGYET 728
            :..|....||||||..|.   |:|  |||:..|.::....|.|.:      ..|....||||..:
Human   724 VRSGEKCWVTGWGRRHEADNKGSL--VLQQAEVELIDQTLCVSTY------GIITSRMLCAGIMS 780

  Fly   729 GGQDSCQGDSGGPLQA-KSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWILEHV 786
            |.:|:|:|||||||.. :..||::.|.||:|||.|....|.|||.||:|.|.|||.::|
Human   781 GKRDACKGDSGGPLSCRRKSDGKWILTGIVSWGHGSGRPNFPGVYTRVSNFVPWIHKYV 839

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 90/248 (36%)
Tryp_SPc 544..785 CDD:238113 91/250 (36%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143782
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.