DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and OVCH1

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_024304736.1 Gene:OVCH1 / 341350 HGNCID:23080 Length:1120 Species:Homo sapiens


Alignment Length:302 Identity:107/302 - (35%)
Similarity:158/302 - (52%) Gaps:34/302 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 RTPVLATSGIETNEISDSSIPDAGALGHVKTISAARSECGVPTLARPE---TRIVGGKSAAFGRW 555
            |..:|.:..:  |:......|....:..||.|  ....||:|..: |:   .||.||:.|....|
Human   562 RFTILPSESL--NKFEPKLPPQNNPVSTVKAI--LHDVCGIPPFS-PQWLSRRIAGGEEACPHCW 621

  Fly   556 PWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLLISQIR-------IRVGEYDFSHVQ 613
            ||||.:|      |...::||||:||..||.||.|||      |::       |..|::| .:::
Human   622 PWQVGLR------FLGDYQCGGAIINPVWILTAAHCV------QLKNNPLSWTIIAGDHD-RNLK 673

  Fly   614 EQLPYIERGVAKK-VVHPKYSFLTYEYDLALVKLEQPLEFAPHVSPICLPET-DSLLIGMNATVT 676
            |....:.|  ||. :||..::.|:|:.|:||::|..|||:...|.|:|||.: :.|.......||
Human   674 ESTEQVRR--AKHIIVHEDFNTLSYDSDIALIQLSSPLEYNSVVRPVCLPHSAEPLFSSEICAVT 736

  Fly   677 GWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIFLCAGYETGGQ-DSCQGDSGG 740
            |||.:|..|.|.|.||::.|.::..:.|:..:..| ....|.:..:|||:...|: |.|||||||
Human   737 GWGSISADGGLASRLQQIQVHVLEREVCEHTYYSA-HPGGITEKMICAGFAASGEKDFCQGDSGG 800

  Fly   741 PLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWI 782
            ||..:.::|.|.|.||:|||.||.:...|||..|:..|..||
Human   801 PLVCRHENGPFVLYGIVSWGAGCVQPWKPGVFARVMIFLDWI 842

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 94/248 (38%)
Tryp_SPc 544..785 CDD:238113 95/249 (38%)
OVCH1XP_024304736.1 Tryp_SPc 58..294 CDD:238113
CUB 336..444 CDD:238001
CUB 454..565 CDD:238001 1/2 (50%)
Tryp_SPc 610..845 CDD:238113 95/249 (38%)
CUB 881..978 CDD:238001
CUB 1017..1119 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.