DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and OVCH2

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_016873148.1 Gene:OVCH2 / 341277 HGNCID:29970 Length:569 Species:Homo sapiens


Alignment Length:292 Identity:105/292 - (35%)
Similarity:161/292 - (55%) Gaps:36/292 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 GHVKTISAARS-ECGVPTLARPE--------TRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRC 575
            |...|:|..:: .|| .:|.:.:        :||:||.....|.:|||||:::      ...|.|
Human    24 GKSATLSLPKAPSCG-QSLVKVQPWNYFNIFSRILGGSQVEKGSYPWQVSLKQ------RQKHIC 81

  Fly   576 GGALINENWIATAGHCVDDL-LISQIRIRVGEYDFSHVQ--EQLPYIERGVAKKVVHPKYSF-LT 636
            ||::::..|:.||.||:.:. ::|.:.:..||||.|...  ||...||    ..::||.:|. ..
Human    82 GGSIVSPQWVITAAHCIANRNIVSTLNVTAGEYDLSQTDPGEQTLTIE----TVIIHPHFSTKKP 142

  Fly   637 YEYDLALVKLEQPLEFAPHVSPICLPE-TDSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPIVS 700
            .:||:||:|:....:|...|.|||||| .:....|...|..|||||:|||.|..|||||::||::
Human   143 MDYDIALLKMAGAFQFGHFVGPICLPELREQFEAGFICTTAGWGRLTEGGVLSQVLQEVNLPILT 207

  Fly   701 NDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGC-- 763
            .:.|.:..:.. ::......|||.|:..||:|:|||||||.|..:::.|.:.|||:.|||:||  
Human   208 WEECVAALLTL-KRPISGKTFLCTGFPDGGRDACQGDSGGSLMCRNKKGAWTLAGVTSWGLGCGR 271

  Fly   764 --------AEANLPGVCTRISKFTPWILEHVR 787
                    ::...||:.|.|||..|||.||::
Human   272 GWRNNVRKSDQGSPGIFTDISKVLPWIHEHIQ 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 95/253 (38%)
Tryp_SPc 544..785 CDD:238113 96/255 (38%)
OVCH2XP_016873148.1 Tryp_SPc 55..298 CDD:214473 95/253 (38%)
Tryp_SPc 56..301 CDD:238113 96/255 (38%)
CUB 320..424 CDD:238001
CUB 435..546 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5374
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4774
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.