DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and TMPRSS11A

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_872412.3 Gene:TMPRSS11A / 339967 HGNCID:27954 Length:421 Species:Homo sapiens


Alignment Length:295 Identity:94/295 - (31%)
Similarity:146/295 - (49%) Gaps:41/295 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 PVLATSGIETNEISDSSIPDAGALGHVKTISAARSECGVPTLARPETRIVGGKSAAFGRWPWQVS 560
            |:.|:| ::.|.:|.|:    |.|    |:.|:   ||...:.....||..|..|....||||.|
Human   154 PINASS-VQVNAMSSST----GEL----TVQAS---CGKRVVPLNVNRIASGVIAPKAAWPWQAS 206

  Fly   561 VRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLLISQIRIRVGEYDFSH-------VQEQLPY 618
            ::      :.:.|:||..||:..|:.||.||..            :|...|       .:...|.
Human   207 LQ------YDNIHQCGATLISNTWLVTAAHCFQ------------KYKNPHQWTVSFGTKINPPL 253

  Fly   619 IERGVAKKVVHPKYSFLTYEYDLALVKLEQPLEFAPHVSPICLPETD-SLLIGMNATVTGWGRLS 682
            ::|.|.:.::|.||.....|||:|:|::...:.|:..:..|||||.. |....:...:||:|.|.
Human   254 MKRNVRRFIIHEKYRSAAREYDIAVVQVSSRVTFSDDIRQICLPEASASFQPNLTVHITGFGALY 318

  Fly   683 EGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQ 747
            .||...:.|:|..|.|:|:|.||.  .:....:..|.:| ||||..|..|:|:|||||||..:..
Human   319 YGGESQNDLREARVKIISDDVCKQ--PQVYGNDIKPGMF-CAGYMEGIYDACRGDSGGPLVTRDL 380

  Fly   748 DGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWI 782
            ...::|.||:|||..|.:.:.|||.|:::.:..||
Human   381 KDTWYLIGIVSWGDNCGQKDKPGVYTQVTYYRNWI 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 80/246 (33%)
Tryp_SPc 544..785 CDD:238113 81/247 (33%)
TMPRSS11ANP_872412.3 SEA 49..147 CDD:279699
Tryp_SPc 189..415 CDD:214473 80/246 (33%)
Tryp_SPc 190..418 CDD:238113 81/247 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143774
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.