DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and prss60.3

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:256 Identity:98/256 - (38%)
Similarity:149/256 - (58%) Gaps:21/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 CGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLL 596
            ||...|   .||||||.:|:.|.||||||:....:.|    |.|||:||:..|:.||.||:..:.
Zfish    27 CGQAPL---NTRIVGGVNASPGSWPWQVSLHSPKYGG----HFCGGSLISSEWVLTAAHCLSGVS 84

  Fly   597 ISQIRIRVGEYDFSHVQEQLPYIE--RGVAKKVVHPKYSFLTYEYDLALVKLEQPLEFAPHVSPI 659
            .:.:.:.:|.    ..|:.:...|  |.|||..||..|:..|.:.|:||::|...:.|..::.|:
Zfish    85 ETTLVVYLGR----RTQQGINIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPV 145

  Fly   660 CLPETDSLL-IGMNATVTGWGRLSEGGTLPS--VLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIF 721
            ||...:|:. .|.::.:||||.:..|..||:  :|||..:|:|:||.|.:: :.:|.   :.:..
Zfish   146 CLAAQNSVYSAGTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRCNAL-LGSGT---VTNNM 206

  Fly   722 LCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWI 782
            :|||...||:|:||||||||:..:... .:..|||.|||.|||:.|.|||.||:|::..||
Zfish   207 ICAGLTQGGKDTCQGDSGGPMVTRLCT-VWVQAGITSWGYGCADPNSPGVYTRVSQYQSWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 92/243 (38%)
Tryp_SPc 544..785 CDD:238113 93/244 (38%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 93/244 (38%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D291432at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.