DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Tmprss11g

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_796136.2 Gene:Tmprss11g / 320454 MGIID:2444058 Length:417 Species:Mus musculus


Alignment Length:280 Identity:96/280 - (34%)
Similarity:144/280 - (51%) Gaps:27/280 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 DSSIPDAGALGHVKTISAAR------SECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFG 568
            |:|:|      :::.::||:      |:||......|..||..||.|....||||.|::      
Mouse   152 DASLP------YLREMNAAQAEHILNSDCGSGMEYPPIARIADGKPADKASWPWQSSLQ------ 204

  Fly   569 FSSTHRCGGALINENWIATAGHCVDDLLISQIRIRVGEYDFSHVQEQLPYIERGVAKKVVHPKYS 633
            ....|.||.:||...|:.|:.||.|:..    ..::....|...... |...|.|...:||..|:
Mouse   205 VEGIHLCGASLIGSQWLVTSAHCFDNYK----NPKLWTVSFGRTLSS-PLTTRKVESIIVHENYA 264

  Fly   634 FLTYEYDLALVKLEQPLEFAPHVSPICLPE-TDSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVP 697
            ...::.|:|:|||..|:.|:.::..:|||: |..:|......|||||.|...|..|:.||||.:.
Mouse   265 SHKHDDDIAVVKLSSPVLFSENLHRVCLPDATFQVLPKSKVFVTGWGALKANGPFPNSLQEVEIE 329

  Fly   698 IVSNDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIG 762
            |:|||.|..:.:..|.   |....:|||:.||..|:|:|||||||.......:::|.||:||||.
Mouse   330 IISNDVCNQVNVYGGA---ISSGMICAGFLTGKLDACEGDSGGPLVISDNRNKWYLLGIVSWGID 391

  Fly   763 CAEANLPGVCTRISKFTPWI 782
            |.:.|.||:.||::.:..||
Mouse   392 CGKENKPGIYTRVTHYRDWI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 85/239 (36%)
Tryp_SPc 544..785 CDD:238113 86/240 (36%)
Tmprss11gNP_796136.2 SEA 48..142 CDD:279699
Tryp_SPc 185..411 CDD:214473 85/239 (36%)
Tryp_SPc 186..414 CDD:238113 86/240 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834022
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.