DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Tmprss6

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_006242057.1 Gene:Tmprss6 / 315388 RGDID:1307138 Length:811 Species:Rattus norvegicus


Alignment Length:266 Identity:97/266 - (36%)
Similarity:141/266 - (53%) Gaps:40/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 ECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDL 595
            :||   |..|.:|||||..::.|.||||.|::      ....|.||||||.:.|:.||.||..:.
  Rat   567 DCG---LQGPSSRIVGGAMSSEGEWPWQASLQ------IRGRHICGGALIADRWVITAAHCFQED 622

  Fly   596 LISQIRIRV-------------GEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLE 647
            .::..|:..             ||..|.            |::..:||.:...:::||:||::|:
  Rat   623 SMASPRLWTVFLGKMRQNSRWPGEVSFK------------VSRLFLHPYHEEDSHDYDVALLQLD 675

  Fly   648 QPLEFAPHVSPICLPETDSLL-IGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRA 711
            .|:.::..|.|:|||...... .|.:..:||||...|||...|.||:|.|.::..|.|...:   
  Rat   676 HPVVYSATVRPVCLPARSHFFEPGQHCWITGWGAQREGGPGSSTLQKVDVQLIPQDLCNEAY--- 737

  Fly   712 GRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRIS 776
             |.:..|.: |||||..|.:|:|||||||||..|...||:||||::|||:||...|..||.||::
  Rat   738 -RYQVTPRM-LCAGYRKGKKDACQGDSGGPLVCKEPSGRWFLAGLVSWGLGCGRPNFFGVYTRVT 800

  Fly   777 KFTPWI 782
            :...||
  Rat   801 RVVNWI 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 91/252 (36%)
Tryp_SPc 544..785 CDD:238113 92/253 (36%)
Tmprss6XP_006242057.1 SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486
Tryp_SPc 576..806 CDD:214473 91/252 (36%)
Tryp_SPc 577..809 CDD:238113 92/253 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337589
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.