DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Tmprss3

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:277 Identity:112/277 - (40%)
Similarity:145/277 - (52%) Gaps:35/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 GHVKTISAARSECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENW 584
            |||.|:..  |.||:.|...|  |||||..::..:||||||::      |...|.|||::|...|
  Rat   197 GHVVTLKC--SACGMRTGYSP--RIVGGNVSSLTQWPWQVSLQ------FQGYHLCGGSVITPLW 251

  Fly   585 IATAGHCVDDLLISQI-RIRVGEYDF------SHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLA 642
            |.||.|||.||...:. .::||....      ||:.|::.|          |.||.......|:|
  Rat   252 IVTAAHCVYDLYHPKSWTVQVGLVSLMDSPVPSHLVEKIIY----------HSKYKPKRLGNDIA 306

  Fly   643 LVKLEQPLEFAPHVSPICLPET-DSLLIGMNATVTGWGRLSEG-GTLPSVLQEVSVPIVSNDNCK 705
            |:||.:||.|...:.|||||.: ::...|.....:|||...:| |....||...:||::||..|.
  Rat   307 LMKLSEPLTFDETIQPICLPNSEENFPDGKLCWTSGWGATEDGAGDASPVLNHAAVPLISNKICN 371

  Fly   706 SMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFF-LAGIISWGIGCAEANLP 769
            ...:..|   .|....|||||..||.|||||||||||..  |:.|.: |.|..|:||||||.|.|
  Rat   372 HRDVYGG---IISPSMLCAGYLKGGVDSCQGDSGGPLVC--QERRLWKLVGATSFGIGCAEVNKP 431

  Fly   770 GVCTRISKFTPWILEHV 786
            ||.|||:.|..||.|.:
  Rat   432 GVYTRITSFLDWIHEQL 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 100/248 (40%)
Tryp_SPc 544..785 CDD:238113 101/250 (40%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055 7/15 (47%)
Tryp_SPc 216..444 CDD:214473 100/248 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44824
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.