DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Ovch2

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_003749007.2 Gene:Ovch2 / 308919 RGDID:1564636 Length:579 Species:Rattus norvegicus


Alignment Length:292 Identity:109/292 - (37%)
Similarity:164/292 - (56%) Gaps:36/292 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 GHVKTISAARS-ECGVPTLARP--------ETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRC 575
            ||..|:|:.|: :|| .:|.:|        .:|||||.....|.:|||||:::      ...|.|
  Rat    20 GHSATLSSIRAPDCG-KSLVKPWPQNYFSLFSRIVGGSQVEKGSYPWQVSLKQ------KQKHIC 77

  Fly   576 GGALINENWIATAGHCVDDLLIS-QIRIRVGEYDFSHVQ--EQLPYIERGVAKKVVHPKYSF-LT 636
            ||.:|:..|:.||.||:.:..|: .:.:..||:|.|..:  ||...||    ..::||::|. ..
  Rat    78 GGTIISSQWVITAAHCMANRNIALTLNVTAGEHDLSQAEPGEQTLAIE----TIIIHPQFSTKKP 138

  Fly   637 YEYDLALVKLEQPLEFAPHVSPICLPET-DSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPIVS 700
            ..||:||:|:....:|...|.|:||||. :....|...|..|||||||||:||.|||:|::||::
  Rat   139 MNYDIALLKMVGTFQFGQFVRPVCLPEPGEQFNAGYICTTAGWGRLSEGGSLPQVLQQVNLPILT 203

  Fly   701 NDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCA- 764
            ::.|:::.:.. |.......|||.|...||:|:|||||||.|..:::.|.:.|||:.|||:||. 
  Rat   204 HEECEAVMLTL-RNPITGKTFLCTGSPDGGRDACQGDSGGSLMCQNRKGAWTLAGVTSWGLGCGR 267

  Fly   765 ---------EANLPGVCTRISKFTPWILEHVR 787
                     |...||:.|.:.:..|||.|||:
  Rat   268 SWRNNARKKEQGSPGIFTDLRRVLPWIHEHVQ 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 95/253 (38%)
Tryp_SPc 544..785 CDD:238113 96/255 (38%)
Ovch2XP_003749007.2 Tryp_SPc 52..297 CDD:238113 96/255 (38%)
CUB 317..420 CDD:238001
CUB 431..541 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.