DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Prss22

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:281 Identity:101/281 - (35%)
Similarity:149/281 - (53%) Gaps:46/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   524 TISAARSECGVPTLARPE--TRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIA 586
            |:|||... |.|...:|:  .|:|||:.:|..:|||.||:.:      :.:|.|.|:|:...|:.
  Rat    29 TVSAANIR-GSPDCGKPQQLNRVVGGEDSADAQWPWIVSILK------NGSHHCAGSLLTNRWVV 86

  Fly   587 TAGHCVDDLLISQIRIRVGEYDFSHVQEQLPYI----------------ERGVAKKVVHPKYSFL 635
            :|.||..                |::.:..||.                :.|:|..:.||:||..
  Rat    87 SAAHCFS----------------SNMDKPSPYSVLLGAWKLGNPGPRSQKVGIASVLPHPRYSRK 135

  Fly   636 TYEY-DLALVKLEQPLEFAPHVSPICLPETD-SLLIGMNATVTGWGRLSEGGTL--PSVLQEVSV 696
            ...: |:|||:||:|::|:..:.|||||::. .|....|..:.|||.:.:|..|  |..||::.|
  Rat   136 EGTHADIALVRLERPIQFSERILPICLPDSSVHLPPNTNCWIAGWGSIQDGVPLPRPQTLQKLKV 200

  Fly   697 PIVSNDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGI 761
            ||:..:.|||::.|...||.|.:..|||||..|.:|:|.|||||||..:..| .:.|.||||||.
  Rat   201 PIIDPELCKSLYWRGAGQEAITEDMLCAGYLEGKRDACLGDSGGPLMCQVDD-HWLLTGIISWGE 264

  Fly   762 GCAEANLPGVCTRISKFTPWI 782
            ||||.|.|||.|.:....||:
  Rat   265 GCAERNRPGVYTSLLAHRPWV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 93/258 (36%)
Tryp_SPc 544..785 CDD:238113 93/259 (36%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 93/258 (36%)
Tryp_SPc 50..288 CDD:238113 93/259 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44824
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.