DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and TMPRSS11E

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_054777.2 Gene:TMPRSS11E / 28983 HGNCID:24465 Length:423 Species:Homo sapiens


Alignment Length:283 Identity:88/283 - (31%)
Similarity:133/283 - (46%) Gaps:49/283 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   522 VKTISAARSE------CGV---PTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGG 577
            :|.|:...::      ||.   .||.: ..|||||.....|.||||.|::      :..:||||.
Human   162 IKKINKTETDSYLNHCCGTRRSKTLGQ-SLRIVGGTEVEEGEWPWQASLQ------WDGSHRCGA 219

  Fly   578 ALINENWIATAGHCVDDLLISQIRIRVGEYDFSHVQEQLPY------------IERGVAKKVVHP 630
            .|||..|:.:|.||                 |:..:....:            ::||:.:.:||.
Human   220 TLINATWLVSAAHC-----------------FTTYKNPARWTASFGVTIKPSKMKRGLRRIIVHE 267

  Fly   631 KYSFLTYEYDLALVKLEQPLEFAPHVSPICLPETD-SLLIGMNATVTGWGRLSEGGTLPSVLQEV 694
            ||...:::||::|.:|..|:.:...|..:|||:.. ....|....|||:|.|...|...:.|::.
Human   268 KYKHPSHDYDISLAELSSPVPYTNAVHRVCLPDASYEFQPGDVMFVTGFGALKNDGYSQNHLRQA 332

  Fly   695 SVPIVSNDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISW 759
            .|.::....|..  .:|......|.: ||||...|..|:|||||||||.:......::||||:||
Human   333 QVTLIDATTCNE--PQAYNDAITPRM-LCAGSLEGKTDACQGDSGGPLVSSDARDIWYLAGIVSW 394

  Fly   760 GIGCAEANLPGVCTRISKFTPWI 782
            |..||:.|.|||.||::....||
Human   395 GDECAKPNKPGVYTRVTALRDWI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 80/251 (32%)
Tryp_SPc 544..785 CDD:238113 81/252 (32%)
TMPRSS11ENP_054777.2 SEA 51..156 CDD:307516
Tryp_SPc 192..420 CDD:238113 81/252 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143778
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.