DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Prss27

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:298 Identity:106/298 - (35%)
Similarity:151/298 - (50%) Gaps:46/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 PVLATSGIETNEISDSSIPDAGALGHVKTISAARSECGVPTLARPETRIVGGKSAAFGRWPWQVS 560
            |:|..||.|..|                    |...||.|   |...|:|||:.|..|.||||||
  Rat    13 PLLLRSGTEGAE--------------------AMRACGHP---RMFNRMVGGEDALEGEWPWQVS 54

  Fly   561 VRRTSFFGFSSTHRCGGALINENWIATAGHC---VDDLLISQIRIRVGEYDFSHVQEQLPYIERG 622
            ::|      :..|.|||:||...|:.||.||   ..|:.|.|:.:..     ..:|:..|:....
  Rat    55 IQR------NGAHFCGGSLIAPTWVLTAAHCFSNTSDISIYQVLLGA-----LKLQQPGPHALYV 108

  Fly   623 VAKKV-VHPKYSFLTYEYDLALVKLEQPLEFAPHVSPICLPETDSLL-IGMNATVTGWGRLSEGG 685
            ..|:| .||:|..:....|:|||:|:.|:.|..::.|:|||:...:. .|||..|||||..||..
  Rat   109 PVKRVKSHPEYQGMASSADVALVELQVPVTFTKYILPVCLPDPSVVFKSGMNCWVTGWGSPSEQD 173

  Fly   686 TLPS--VLQEVSVPIVSNDNCKSMFMRAGRQEF----IPDIFLCAGYETGGQDSCQGDSGGPLQA 744
            .||:  :||:::||::....|..::.:....:.    |.|..||||:..|.:|:|:|||||||..
  Rat   174 RLPNPRILQKLAVPLIDTPKCNLLYSKDAEADIQLKTIKDDMLCAGFAEGKKDACKGDSGGPLVC 238

  Fly   745 KSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWI 782
             ..|..:..||:||||.|||..|.|||..|::....||
  Rat   239 -LVDQSWVQAGVISWGEGCARRNRPGVYIRVASHYQWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 93/249 (37%)
Tryp_SPc 544..785 CDD:238113 94/250 (38%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 93/249 (37%)
Tryp_SPc 39..278 CDD:238113 94/249 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.