DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and PRSS33

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:279 Identity:103/279 - (36%)
Similarity:142/279 - (50%) Gaps:25/279 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   517 GALGHVKTISAARSECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALIN 581
            ||.|.....|||   ||.|   |..:|||||:....|.||||.|::.      ...|.|||:||.
Human    16 GAAGTQGRKSAA---CGQP---RMSSRIVGGRDGRDGEWPWQASIQH------RGAHVCGGSLIA 68

  Fly   582 ENWIATAGHCVD-DLLISQIRIRVGEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVK 645
            ..|:.||.||.. ..|.::.|:|:|.........:.  :...|.:.::.|.||......||||::
Human    69 PQWVLTAAHCFPRRALPAEYRVRLGALRLGSTSPRT--LSVPVRRVLLPPDYSEDGARGDLALLQ 131

  Fly   646 LEQPLEFAPHVSPICLPETDSL-LIGMNATVTGWGRLSEGGTLPS--VLQEVSVPIVSNDNCKSM 707
            |.:|:..:..|.|:|||...:. ..|....|||||.|..|..||.  .||.|.||::.:..|..:
Human   132 LRRPVPLSARVQPVCLPVPGARPPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTCDGL 196

  Fly   708 F-----MRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEAN 767
            :     :....:..:|. .|||||..|.:|:|||||||||.. .|.|.:.|.|::|||.|||..|
Human   197 YHVGADVPQAERIVLPG-SLCAGYPQGHKDACQGDSGGPLTC-LQSGSWVLVGVVSWGKGCALPN 259

  Fly   768 LPGVCTRISKFTPWILEHV 786
            .|||.|.::.::|||...|
Human   260 RPGVYTSVATYSPWIQARV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 90/247 (36%)
Tryp_SPc 544..785 CDD:238113 91/249 (37%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 90/247 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.