DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and TPSG1

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:312 Identity:103/312 - (33%)
Similarity:146/312 - (46%) Gaps:54/312 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   504 ETNEISDSSIPDAGALGHVK---------------TISAARSECGVPTLARPETRIVGGKSAAFG 553
            :|.|:.......||..|..:               |.|:....||.|.::....|||||.:|..|
Human     8 QTRELKSKVPKKAGRCGQGRLHGGSAVGFLGSPPGTPSSFDLGCGRPQVSDAGGRIVGGHAAPAG 72

  Fly   554 RWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVD-DLLISQIRIRVGEYD------FSH 611
            .||||.|:|      ....|.|||:|::..|:.||.||.. .|..|..::.:||.:      ||.
Human    73 AWPWQASLR------LRRVHVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHLGELEITLSPHFST 131

  Fly   612 VQEQL----PYIERGVAKKVVHPKYSFLTYEYDLALVKLEQPLEFAPHVSPICLPE-TDSLLIGM 671
            |::.:    |..:.|.:.              |:|||:|..|:..:..:.|:|||| :|....|:
Human   132 VRQIILHSSPSGQPGTSG--------------DIALVELSVPVTLSSRILPVCLPEASDDFCPGI 182

  Fly   672 NATVTGWGRLSEGGTLPS--VLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSC 734
            ...|||||...||..||.  .|:||.|.:|..:.|:..:...|.....||: |||   .|..|:|
Human   183 RCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDM-LCA---RGPGDAC 243

  Fly   735 QGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWILEHV 786
            |.||||||..: .:|.:..||.:|||.||...|.|||.||:..:..||..|:
Human   244 QDDSGGPLVCQ-VNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRHI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 90/252 (36%)
Tryp_SPc 544..785 CDD:238113 91/254 (36%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 90/252 (36%)
Tryp_SPc 63..293 CDD:238113 91/254 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.