DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Klkb1

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:379 Identity:120/379 - (31%)
Similarity:178/379 - (46%) Gaps:65/379 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   463 KTPTTTRP----ISSSSSSSSGIVTSSQRPTQPTHRTPVLATSGIETNEISDSSIPDAGALGH-- 521
            ||..:.||    |..::.|...:.|..:...:|.| ..:.:....|..|::.:.:..|.|...  
  Rat   259 KTSKSGRPSPPIIQENAVSGYSLFTCRKARPEPCH-FKIYSGVAFEGEELNATFVQGADACQETC 322

  Fly   522 VKTI-------SAARSEC--------------GVPT-------------------------LARP 540
            .|||       |....:|              |.||                         ..:.
  Rat   323 TKTIRCQFFTYSLLPQDCKAEGCKCSLRLSTDGSPTRITYEAQGSSGYSLRLCKVVESSDCTTKI 387

  Fly   541 ETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLLISQI-RIRV 604
            ..|||||.:::.|.||||||::...   .|..|.|||::|...||.||.||.|.:....: ||..
  Rat   388 NARIVGGTNSSLGEWPWQVSLQVKL---VSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYG 449

  Fly   605 GEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLEQPLEFAPHVSPICLP-ETDSLL 668
            |..:.|.:..:.|:  ..:.:.::|.||......||:||:||:.||.:.....||||| :.|:..
  Rat   450 GILNLSEITNKTPF--SSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNT 512

  Fly   669 IGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDS 733
            |..|..|||||...|.|...::||:.::|:|.|:.|:..:    |...|....:||||:.||.|:
  Rat   513 IYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKY----RDYVITKQMICAGYKEGGIDA 573

  Fly   734 CQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWILEHVR 787
            |:|||||||..| ..||:.|.||.|||.|||....|||.|:::::..||||.::
  Rat   574 CKGDSGGPLVCK-HSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQ 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 95/240 (40%)
Tryp_SPc 544..785 CDD:238113 97/242 (40%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519 6/24 (25%)
APPLE 292..375 CDD:128519 13/83 (16%)
Tryp_SPc 390..621 CDD:214473 95/240 (40%)
Tryp_SPc 391..621 CDD:238113 94/239 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 189 1.000 Domainoid score I3197
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44824
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.