DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Ovch2

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_766496.2 Gene:Ovch2 / 244199 MGIID:3045251 Length:609 Species:Mus musculus


Alignment Length:294 Identity:108/294 - (36%)
Similarity:167/294 - (56%) Gaps:40/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 GHVKTISAARS-ECGVPTLARPE--------TRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRC 575
            ||.:|:|:.|: :|| .:|.:|:        :|||||.....|.:|||||:::      ...|.|
Mouse    20 GHSETLSSIRNPDCG-QSLVKPQPQNYFSLFSRIVGGSQVEKGSYPWQVSLKQ------KQKHIC 77

  Fly   576 GGALINENWIATAGHCVDDLLIS-QIRIRVGEYDFSHVQ--EQLPYIERGVAKKVVHPKYSFLTY 637
            ||.:|:..|:.||.||:.:..|: .:.:..||:|.|..:  ||...||    ..::||::|  |.
Mouse    78 GGTIISSQWVITAAHCMANRNIALTLNVTAGEHDLSQAEPGEQTLAIE----TIIIHPQFS--TR 136

  Fly   638 E---YDLALVKLEQPLEFAPHVSPICLPET-DSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPI 698
            :   ||:||:|:....:|...|.|:||||. :....|...|..|||||||||.||.|||:|::||
Mouse   137 KPMIYDIALLKMAGTFQFGQFVRPVCLPEPGEHFNAGFICTTAGWGRLSEGGRLPQVLQQVNLPI 201

  Fly   699 VSNDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGC 763
            ::.:.|:::.:.. :.......|||.|...||:|:|||||||.|..:::.|.:.|||:.|||:||
Mouse   202 LTQEECEAVLLTL-KNPITGKTFLCTGSPDGGRDACQGDSGGSLMCQNRKGAWTLAGVTSWGLGC 265

  Fly   764 A----------EANLPGVCTRISKFTPWILEHVR 787
            .          |...||:.|.:.:..||||:|::
Mouse   266 GRSWRNNARKKEQGSPGIFTDLRRVLPWILKHIQ 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 95/255 (37%)
Tryp_SPc 544..785 CDD:238113 97/257 (38%)
Ovch2NP_766496.2 Tryp_SPc 51..294 CDD:214473 95/255 (37%)
Tryp_SPc 52..297 CDD:238113 97/257 (38%)
CUB 317..420 CDD:238001
CUB 431..542 CDD:238001
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 580..609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5374
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4774
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.