DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Tmprss11e

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_766468.1 Gene:Tmprss11e / 243084 MGIID:3513175 Length:423 Species:Mus musculus


Alignment Length:274 Identity:90/274 - (32%)
Similarity:130/274 - (47%) Gaps:30/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   522 VKTISAARSE------CGV---PTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGG 577
            :|.|:...|:      ||.   .:..:...|||||.......||||.|:|      :..:||||.
Mouse   161 IKKINKTESDNYFNHCCGTRRNKSTVQTSVRIVGGTPVEEEEWPWQSSLR------WDGSHRCGA 219

  Fly   578 ALINENWIATAGHCVDDLLISQIRIRVGEYDFS---HVQEQLPYIERGVAKKVVHPKYSFLTYEY 639
            .|||..|:.||.||        .|.......:|   ....|...:..|:.:.:||.||.:.:::|
Mouse   220 TLINNTWLVTAAHC--------FRTHKDPSRWSATFGATLQPRKLTTGIRRIIVHEKYKYPSHDY 276

  Fly   640 DLALVKLEQPLEFAPHVSPICLPETD-SLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDN 703
            |:||.:|.:|:.....|..:|||:.: ....|....|||:|.|...|...:.|::|.|..:....
Mouse   277 DIALAELSKPVPCTNAVHKVCLPDANHEFQPGQRMFVTGFGALKNDGFTQNNLRQVQVDYIDTQT 341

  Fly   704 CKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANL 768
            |.......|.   |....||||:..|.:|:|||||||||........::|||::|||..|.:.|.
Mouse   342 CNQPQSYNGA---ITPRMLCAGFLKGEKDACQGDSGGPLVTADVRDIWYLAGVVSWGDECGQPNK 403

  Fly   769 PGVCTRISKFTPWI 782
            |||.||::.|..||
Mouse   404 PGVYTRVTAFRHWI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 83/242 (34%)
Tryp_SPc 544..785 CDD:238113 84/243 (35%)
Tmprss11eNP_766468.1 SEA 50..145 CDD:279699
Tryp_SPc 191..417 CDD:214473 83/242 (34%)
Tryp_SPc 192..420 CDD:238113 84/243 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834006
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.