DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Tmprss11f

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_848845.1 Gene:Tmprss11f / 243083 MGIID:2442348 Length:439 Species:Mus musculus


Alignment Length:275 Identity:89/275 - (32%)
Similarity:133/275 - (48%) Gaps:48/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 SECG-------VPTLARPET-RIVGGKSAAF-GRWPWQVSVRRTSFFGFSSTHRCGGALINENWI 585
            |.||       :|..|...| |||.|:..|. |.||||.|::.     ..:.|:||..||:..|:
Mouse   185 SRCGIRMSSSNIPLPASSSTERIVQGRETAMEGEWPWQASLQL-----IGAGHQCGATLISNTWL 244

  Fly   586 ATAGHCVDDLLISQIRIRVGEYDFSHVQEQL------------PYIERGVAKKVVHPKYSFLTYE 638
            .||.||                 |...::..            |.::|.|.|.::|.:|...|.|
Mouse   245 LTAAHC-----------------FWKNRDPTKWIVTFGTTITPPLVKRSVGKIIIHEEYHRDTNE 292

  Fly   639 YDLALVKLEQPLEFAPHVSPICLPETDSLLIGMNAT-VTGWGRLSEGGTLPSVLQEVSVPIVSND 702
            .|:||.:|...:||:..|..:|||::...|....:. |||:|.:.:.|...:.|::..|..:.:|
Mouse   293 NDIALAQLTTRVEFSNVVQRVCLPDSSMKLPPKTSVFVTGFGSIVDDGPTQNKLRQARVETIGSD 357

  Fly   703 NCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEAN 767
            .|....:..|   .|....||||:..|..|:|:|||||||...::| .:::.||:|||..||..|
Mouse   358 VCNRKDVYDG---LITPGMLCAGFMEGKIDACKGDSGGPLVYDNRD-IWYIVGIVSWGQSCALPN 418

  Fly   768 LPGVCTRISKFTPWI 782
            .|||.||::|:..||
Mouse   419 KPGVYTRVTKYRDWI 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 81/252 (32%)
Tryp_SPc 544..785 CDD:238113 82/253 (32%)
Tmprss11fNP_848845.1 SEA 60..164 CDD:396113
Tryp_SPc 207..436 CDD:238113 82/253 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834044
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.