DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Prss47

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_006517555.1 Gene:Prss47 / 218304 MGIID:2685120 Length:370 Species:Mus musculus


Alignment Length:335 Identity:102/335 - (30%)
Similarity:153/335 - (45%) Gaps:70/335 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 RPISSSSSSSSGIVTSSQRPTQPTHRTPVLATSGIETNEISDSSIPDAGALGHVKTISAARSE-- 531
            :|...::|..|||.....:|.|           |.|.                    ||:|::  
Mouse    26 KPSIPNASKVSGIAPGRPQPQQ-----------GWEP--------------------SASRNQYP 59

  Fly   532 -----CGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHC 591
                 ||.|.:.   .::.||:....|:||||.|:.      :...|.||..||:.:|:|:..||
Mouse    60 VNRPVCGKPKMV---GKVFGGQDTLAGQWPWQASLL------YRGVHLCGAVLIDTHWLASTAHC 115

  Fly   592 VDDLLISQIRIRVGEYDFSHVQEQLPYIERGVAKK------VVHPKY-SFLTYEYDLALVKLEQP 649
            ..:.  ||   ...:|:......|| |.|....:|      |.||.: .|.::..|:|:::|..|
Mouse   116 FRNK--SQ---APEDYEVLLGNNQL-YQETKHTQKISVNHIVSHPDFEKFHSFGSDIAMLQLHLP 174

  Fly   650 LEFAPHVSPICLPETDSLLIGMNAT---VTGWGRLSEGGTL--PSVLQEVSVPIVSNDNCKSMFM 709
            :.|..:|.|.|||..|:.|  .|.|   :||||.|||...|  |..|||..|.|:.|:.|.:::.
Mouse   175 INFTSYVVPACLPSKDTQL--SNHTSCWITGWGMLSEDTKLLPPFSLQEGEVGIIDNEFCNALYG 237

  Fly   710 RAGRQ--EFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVC 772
            :...|  .::.:..||||..:.|:..|:|||||||.. ..:..:.|.|:.|||:.|.....|.|.
Mouse   238 QTPGQSRNYVYEEMLCAGGLSTGKSICRGDSGGPLIC-YHNSTWVLVGLASWGLDCRHPIYPSVF 301

  Fly   773 TRISKFTPWI 782
            ||::.||.||
Mouse   302 TRVAYFTDWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 85/252 (34%)
Tryp_SPc 544..785 CDD:238113 87/253 (34%)
Prss47XP_006517555.1 Tryp_SPc 74..314 CDD:238113 87/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.