DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Tmprss7

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_766043.3 Gene:Tmprss7 / 208171 MGIID:2686594 Length:829 Species:Mus musculus


Alignment Length:263 Identity:96/263 - (36%)
Similarity:133/263 - (50%) Gaps:25/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 CGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLL 596
            ||....:....|||||..:..|.||||||:.      |..:..||.::|:..|:.:|.||.....
Mouse   580 CGCSRSSSFLHRIVGGSDSQEGTWPWQVSLH------FVGSAYCGASVISREWLLSAAHCFHGNR 638

  Fly   597 ISQ---IRIRVGEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLE--QPLEFAPHV 656
            :|.   ....:|.|    ||....:|. .|.:.|||..|:..|::||:||::|.  .|......:
Mouse   639 LSDPTPWTAHLGMY----VQGNAKFIS-PVRRIVVHEYYNSQTFDYDIALLQLSIAWPETLKQLI 698

  Fly   657 SPICLPET-DSLLIGMNATVTGWGRLSEGGTLPS-VLQEVSVPIVSNDNCKSMFMRAGRQEFIPD 719
            .|||:|.. ..:..|....||||||..|..:..| |||:..|.::....|.|.:      ..|..
Mouse   699 QPICIPPAGQKVRSGEKCWVTGWGRRHEADSKGSPVLQQAEVELIDQTVCVSTY------GIITS 757

  Fly   720 IFLCAGYETGGQDSCQGDSGGPLQA-KSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWIL 783
            ..||||..:|..|:|:|||||||.. :..||::.|.||:|||.||...|.|||.||:|.|.|||.
Mouse   758 RMLCAGVMSGKSDACKGDSGGPLSCRRKSDGKWILTGIVSWGHGCGRPNFPGVYTRVSSFVPWIH 822

  Fly   784 EHV 786
            ::|
Mouse   823 KYV 825

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 91/246 (37%)
Tryp_SPc 544..785 CDD:238113 92/248 (37%)
Tmprss7NP_766043.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..52
SEA 94..194 CDD:366610
CUB <257..345 CDD:238001
LDLa 470..504 CDD:238060
LDLa 545..580 CDD:238060 96/263 (37%)
Tryp_SPc 591..821 CDD:214473 91/246 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834010
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.