DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Prss8

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:269 Identity:98/269 - (36%)
Similarity:149/269 - (55%) Gaps:18/269 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 ISAARSECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAG 589
            |.|..:|.....:.:|  ||.||.||..|:||||||:.      ::..|.|||:|::..|:.:|.
  Rat    28 IGADGTEASCGAVIQP--RITGGGSAKPGQWPWQVSIT------YNGVHVCGGSLVSNQWVVSAA 84

  Fly   590 HCVD-DLLISQIRIRVGEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLEQPLEFA 653
            ||.. :....:..:::|.:........:  :...||:.:.|..|.....:.|:||::|..|:.|:
  Rat    85 HCFPREHSKEEYEVKLGAHQLDSFSNDI--VVHTVAQIISHSSYREEGSQGDIALIRLSSPVTFS 147

  Fly   654 PHVSPICLPETD-SLLIGMNATVTGWGRLSEGGTL--PSVLQEVSVPIVSNDNCKSMF-MRAGRQ 714
            .::.|||||..: |...|::.||||||.::...:|  |..||::.||::|.:.|..:: :.|..:
  Rat   148 RYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPE 212

  Fly   715 E--FIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISK 777
            |  .|....|||||..||:|:|||||||||.... ||.::||||:|||..|...|.|||.|..|.
  Rat   213 EPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPI-DGLWYLAGIVSWGDACGAPNRPGVYTLTST 276

  Fly   778 FTPWILEHV 786
            :..||..||
  Rat   277 YASWIHHHV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 90/245 (37%)
Tryp_SPc 544..785 CDD:238113 91/247 (37%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 90/245 (37%)
Tryp_SPc 45..284 CDD:238113 91/247 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D291432at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.