DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and St14

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_036010597.1 Gene:St14 / 19143 MGIID:1338881 Length:875 Species:Mus musculus


Alignment Length:265 Identity:99/265 - (37%)
Similarity:150/265 - (56%) Gaps:25/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 ECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDL 595
            :||:.:..: :.|:|||.:|..|.||||||:.     .....|.||.:||:.:|:.:|.||..| 
Mouse   623 DCGLRSFTK-QARVVGGTNADEGEWPWQVSLH-----ALGQGHLCGASLISPDWLVSAAHCFQD- 680

  Fly   596 LISQIRIRVGEYD----FSHVQEQLPYIERGV----AKKVV-HPKYSFLTYEYDLALVKLEQPLE 651
               ....:..:|.    |..:.:|......||    .|::: ||.::..|::||:||::||:.:|
Mouse   681 ---DKNFKYSDYTMWTAFLGLLDQSKRSASGVQELKLKRIITHPSFNDFTFDYDIALLELEKSVE 742

  Fly   652 FAPHVSPICLPE-TDSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQE 715
            ::..|.|||||: |.....|....|||||...||||...:||:..:.:::...|:.:.    .|:
Mouse   743 YSTVVRPICLPDATHVFPAGKAIWVTGWGHTKEGGTGALILQKGEIRVINQTTCEDLM----PQQ 803

  Fly   716 FIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTP 780
            ..|.: :|.|:.:||.|||||||||||.:..:|||.|.||::|||.|||:.|.|||.||:.....
Mouse   804 ITPRM-MCVGFLSGGVDSCQGDSGGPLSSAEKDGRMFQAGVVSWGEGCAQRNKPGVYTRLPVVRD 867

  Fly   781 WILEH 785
            ||.||
Mouse   868 WIKEH 872

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 93/248 (38%)
Tryp_SPc 544..785 CDD:238113 94/250 (38%)
St14XP_036010597.1 SEA 108..198 CDD:396113
CUB 247..352 CDD:238001
CUB 360..464 CDD:238001
LDLa 474..506 CDD:238060
LDLa 512..543 CDD:238060
LDLa 545..579 CDD:238060
LDLa 587..622 CDD:238060
Tryp_SPc 635..872 CDD:238113 94/250 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834032
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.