DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and TMPRSS6

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001275929.1 Gene:TMPRSS6 / 164656 HGNCID:16517 Length:824 Species:Homo sapiens


Alignment Length:292 Identity:100/292 - (34%)
Similarity:147/292 - (50%) Gaps:62/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 ECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCV-DD 594
            :||   |..|.:|||||..::.|.||||.|::      ....|.||||||.:.|:.||.||. :|
Human   558 DCG---LQGPSSRIVGGAVSSEGEWPWQASLQ------VRGRHICGGALIADRWVITAAHCFQED 613

  Fly   595 LLISQIRIRV------------GEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLE 647
            .:.|.:...|            ||..|.            |::.::||.:...:::||:||::|:
Human   614 SMASTVLWTVFLGKVWQNSRWPGEVSFK------------VSRLLLHPYHEEDSHDYDVALLQLD 666

  Fly   648 QPLEFAPHVSPICLPETDSLL-IGMNATVTGWGRLSEGG----------------------TLPS 689
            .|:..:..|.|:|||...... .|::..:||||.|.||.                      .:.:
Human   667 HPVVRSAAVRPVCLPARSHFFEPGLHCWITGWGALREGALRADAVALFYGWRNQGSETCCCPISN 731

  Fly   690 VLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLA 754
            .||:|.|.::..|.|..::    |.:..|.: |||||..|.:|:|||||||||..|:..||:|||
Human   732 ALQKVDVQLIPQDLCSEVY----RYQVTPRM-LCAGYRKGKKDACQGDSGGPLVCKALSGRWFLA 791

  Fly   755 GIISWGIGCAEANLPGVCTRISKFTPWILEHV 786
            |::|||:||...|..||.|||:....||.:.|
Human   792 GLVSWGLGCGRPNYFGVYTRITGVISWIQQVV 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 93/274 (34%)
Tryp_SPc 544..785 CDD:238113 94/276 (34%)
TMPRSS6NP_001275929.1 SEA 77..177 CDD:307516
CUB 326..440 CDD:238001
LDLa 450..480 CDD:238060
LDLa 486..516 CDD:238060
Ldl_recept_a 520..557 CDD:278486
Tryp_SPc 568..822 CDD:238113 94/276 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143818
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.