DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Tmprss3

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001157248.1 Gene:Tmprss3 / 140765 MGIID:2155445 Length:475 Species:Mus musculus


Alignment Length:276 Identity:112/276 - (40%)
Similarity:144/276 - (52%) Gaps:34/276 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 GHVKTISAARSECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENW 584
            |||.|:..  |.||..|...|  |||||..::..:||||||::      |...|.|||::|...|
Mouse   219 GHVVTLKC--SACGTRTGYSP--RIVGGNMSSLTQWPWQVSLQ------FQGYHLCGGSIITPLW 273

  Fly   585 IATAGHCVDDLLISQI-RIRVGEYDF------SHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLA 642
            |.||.|||.||...:. .::||....      ||:.|::.|          |.||.......|:|
Mouse   274 IVTAAHCVYDLYHPKSWTVQVGLVSLMDSPVPSHLVEKIIY----------HSKYKPKRLGNDIA 328

  Fly   643 LVKLEQPLEFAPHVSPICLPET-DSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKS 706
            |:||.:||.|...:.|||||.: ::...|.....:|||...:||....||...:||::||..|..
Mouse   329 LMKLSEPLTFDETIQPICLPNSEENFPDGKLCWTSGWGATEDGGDASPVLNHAAVPLISNKICNH 393

  Fly   707 MFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFF-LAGIISWGIGCAEANLPG 770
            ..:..|   .|....|||||..||.|||||||||||..  |:.|.: |.|..|:||||||.|.||
Mouse   394 RDVYGG---IISPSMLCAGYLKGGVDSCQGDSGGPLVC--QERRLWKLVGATSFGIGCAEVNKPG 453

  Fly   771 VCTRISKFTPWILEHV 786
            |.|||:.|..||.|.:
Mouse   454 VYTRITSFLDWIHEQL 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 100/247 (40%)
Tryp_SPc 544..785 CDD:238113 101/249 (41%)
Tmprss3NP_001157248.1 LDLa 96..129 CDD:238060
SRCR_2 134..233 CDD:292133 7/15 (47%)
Tryp_SPc 238..465 CDD:214473 100/247 (40%)
Tryp_SPc 239..468 CDD:238113 101/249 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834016
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8807
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.