DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and PRSS21

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:305 Identity:110/305 - (36%)
Similarity:151/305 - (49%) Gaps:54/305 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 VLATSGIETNEISDSSIPDAGALGHVKTISAARSECGVPTLARPETRIVGGKSAAFGRWPWQVSV 561
            :||.:|:...| |..:.|.:|             .||...:.   :|||||:.|..||||||.|:
Human    12 LLARAGLRKPE-SQEAAPLSG-------------PCGRRVIT---SRIVGGEDAELGRWPWQGSL 59

  Fly   562 RRTSFFGFSSTHRCGGALINENWIATAGHCVD---DLL-ISQIRIRVGEYDF--SHVQEQLPYIE 620
            |      ...:|.||.:|::..|..||.||.:   ||. .|...::.|:...  |....|..|..
Human    60 R------LWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTR 118

  Fly   621 RGVAKKVVHPKYSFLTYEYDLALVKLEQPLEFAPHVSPICLP--------ETDSLLIGMNATVTG 677
            ..|:...:.|:| .....||:|||||..|:.:..|:.||||.        .||       ..|||
Human   119 YFVSNIYLSPRY-LGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTD-------CWVTG 175

  Fly   678 WGRLSEGGTLPS--VLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIF---LCAGYETGGQDSCQGD 737
            ||.:.|...|||  .||||.|.|::|..|..:|:   :..|..|||   :|||...||:|:|.||
Human   176 WGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFL---KYSFRKDIFGDMVCAGNAQGGKDACFGD 237

  Fly   738 SGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWI 782
            ||||| |.:::|.::..|::|||:||...|.|||.|.||....||
Human   238 SGGPL-ACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 99/257 (39%)
Tryp_SPc 544..785 CDD:238113 100/258 (39%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 100/258 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143814
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40690
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.