DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and Prss50

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_017451624.2 Gene:Prss50 / 100910205 RGDID:6499372 Length:424 Species:Rattus norvegicus


Alignment Length:388 Identity:106/388 - (27%)
Similarity:171/388 - (44%) Gaps:93/388 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 PTRPYQRPTTATSSSSTSTTSSKTPTTTRPISSSSSSSSGIVTSS--QRPTQPTHRTPVLATSGI 503
            |.||   .....:..|.:|.|:..||..|    :|.:||||..|.  :.|.|.            
  Rat    60 PRRP---AGCLAAGESPATLSTAVPTGPR----ASCASSGICPSGRLRLPRQD------------ 105

  Fly   504 ETNEISDSSIPDAGALGHVKTI----SAARSE------CGV-----PTLARPETRIVGGKSAAFG 553
            :|::.|.::.|..| :|.:.|:    |.::::      ||.     |||..||        |...
  Rat   106 QTSDTSQTTTPPKG-MGALSTVGITGSVSKTKPGNLPLCGSSQEPDPTLRDPE--------AMTR 161

  Fly   554 RWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLLISQIR----IRVGEYDFSHVQE 614
            ||||.|||:.      :.:|.|.|.||...|:....||     :||.|    :|||.        
  Rat   162 RWPWMVSVQT------NGSHVCAGILIASQWVLAVAHC-----LSQNRVNYTVRVGS-------- 207

  Fly   615 QLPYIER--------GVAKKVVHPKY------SFLTYEYDLALVKLEQPLEFAPHVSPICLPETD 665
              |:|.:        .|.:.:::..|      |::...:|:.|:||:..|:::.:|.|:|||..:
  Rat   208 --PWINQTTETSSDVPVNQVIINSGYQSKRYWSWVGRIHDIGLLKLKWGLKYSKYVWPVCLPGLE 270

  Fly   666 SLL-IGMNATVTGWGRLSEGGTLP--SVLQEVSVPIVSNDNCKSMFMRAGR----QEFIPDIFLC 723
            .:: .|...||||||.....|..|  ..|||..|.|:::..|:..:.:..|    ...|....:|
  Rat   271 YVVEDGSLCTVTGWGYPKANGLWPQFQTLQEKEVSILNSRECEHYYHKFSRIHSLVRIISPQMIC 335

  Fly   724 AGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWILEHV 786
            | .:...:..|...||.||.. |.||.::|.|::|||.||.::..|.:..::|.:..||.:.:
  Rat   336 A-LDNDREKFCYERSGEPLVC-SSDGMWYLVGVMSWGPGCKKSEAPPIFLQVSHYQLWIWDRL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 73/263 (28%)
Tryp_SPc 544..785 CDD:238113 75/265 (28%)
Prss50XP_017451624.2 Tryp_SPc 162..392 CDD:238113 72/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.