DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and LOC100331291

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_009295692.1 Gene:LOC100331291 / 100331291 -ID:- Length:932 Species:Danio rerio


Alignment Length:270 Identity:99/270 - (36%)
Similarity:141/270 - (52%) Gaps:33/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 CGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLL 596
            ||..|..|...:||||..|..|.||||||::...:     .|.||.:|:...|:.:|.||..|  
Zfish   679 CGCGTRPRKRAKIVGGTDAQAGSWPWQVSLQMERY-----GHVCGASLVASRWLVSAAHCFQD-- 736

  Fly   597 ISQIRIRVGEYDFSHVQEQLPYI-------------ERGVAKKVVHPKYSFLTYEYDLALVKLEQ 648
                   .....:|..:....|:             .|.:.:.|:|.:|...|.:||:||::|..
Zfish   737 -------SDAIKYSDARSWRAYMGMRVMNSVSNAAATRQIRRIVLHSQYDQFTSDYDIALLELSA 794

  Fly   649 PLEFAPHVSPICLPETDSLLI-GMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAG 712
            |:.|...|.|:|:|....:.. |.:..|||||.|:|.|.|.::|||.:|.|::::.|..|:    
Zfish   795 PVFFNELVQPVCVPAPSHVFTSGTSCFVTGWGVLTEEGELATLLQEATVNIINHNTCNKMY---- 855

  Fly   713 RQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISK 777
             .:.:....||||...||.|:|||||||||....:..|:|||||:|||.|||..|.|||.||:.|
Zfish   856 -DDAVTPRMLCAGNIQGGVDACQGDSGGPLVCLERGRRWFLAGIVSWGEGCARQNRPGVYTRVIK 919

  Fly   778 FTPWILEHVR 787
            ||.||.:..:
Zfish   920 FTDWIHQQTK 929

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 93/252 (37%)
Tryp_SPc 544..785 CDD:238113 95/254 (37%)
LOC100331291XP_009295692.1 SEA 136..>220 CDD:307516
CUB 315..415 CDD:238001
CUB 421..528 CDD:238001
LDLa 536..568 CDD:238060
LDLa 606..636 CDD:238060
LDLa 644..679 CDD:238060 99/270 (37%)
Tryp_SPc 691..927 CDD:238113 95/254 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I3236
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25354
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.