DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and tmprss12

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_031751504.1 Gene:tmprss12 / 100127698 XenbaseID:XB-GENE-964846 Length:324 Species:Xenopus tropicalis


Alignment Length:271 Identity:99/271 - (36%)
Similarity:143/271 - (52%) Gaps:20/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 ISAARSE-CGVPTLAR-PETRIVGGKSAAFGRWPWQVSVR--RTSFFGFSSTHRCGGALINENWI 585
            |.|..|| ||.|.|.. |.:|||||::|..|.||||||::  || ..|:|  |||||:||..||:
 Frog    20 IQAIDSEVCGEPPLVHTPGSRIVGGRNALPGAWPWQVSLQYFRT-LSGYS--HRCGGSLIQNNWV 81

  Fly   586 ATAGHCVDDLLISQI-RIRVGEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLEQP 649
            .:|.||.......:. |..:|.::.  ..|..|.::..:.:.::|..|..:....|:||:.|...
 Frog    82 LSAAHCFRANRNPEYWRAVLGLHNI--FMEGSPVVKAKIKQIIIHASYDHIAITNDIALLLLHDF 144

  Fly   650 LEFAPHVSPICLPET---DSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRA 711
            :.::.::.|:||...   |||..   ..:||||...|.|::..:|||..|..:....|.|.....
 Frog   145 VTYSDYIHPVCLGSVTVPDSLTA---CFITGWGVTKEKGSISVILQEALVQTIPYSECNSSSSYN 206

  Fly   712 GRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQA-KSQDGRFFLAGIISWGIGCAEANLPGVCTRI 775
            |   ||....:|||..:|..||||||||||... .::..||:..||.|:|.||.:.|.|||.|::
 Frog   207 G---FITQSMICAGDNSGAVDSCQGDSGGPFVCYNTERMRFYQMGITSFGYGCGKPNFPGVYTKV 268

  Fly   776 SKFTPWILEHV 786
            ..:..||..|:
 Frog   269 ESYVSWIKAHM 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 87/245 (36%)
Tryp_SPc 544..785 CDD:238113 88/247 (36%)
tmprss12XP_031751504.1 Tryp_SPc 41..278 CDD:238113 88/247 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.