DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and zgc:165423

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:279 Identity:104/279 - (37%)
Similarity:158/279 - (56%) Gaps:29/279 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   522 VKTISAARSECGVPTLARP-------ETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGAL 579
            |.|:.:...:| .||.:.|       .|:||||.:|:.|.||||.|:..      |.:|.|||:|
Zfish    10 VVTLLSTGCDC-QPTQSPPACGKAPLNTKIVGGTNASAGSWPWQASLHE------SGSHFCGGSL 67

  Fly   580 INENWIATAGHCV-DDLLISQIRIRVGEYDFSHVQEQLP---YIERGVAKKVVHPKYSFLTYEYD 640
            |::.||.:|.||. .:...|...:.:|..     .:.||   .:.:.|::.:|||.|...|::.|
Zfish    68 ISDQWILSAAHCFPSNPNPSDYTVYLGRQ-----SQDLPNPNEVSKSVSQVIVHPLYQGSTHDND 127

  Fly   641 LALVKLEQPLEFAPHVSPICLPETDSLLIGMNATVTGWGRLSEGGTLPS--VLQEVSVPIVSNDN 703
            :||:.|..|:.|:.::.|:||....|........:||||.:..|.:|||  :||||:||||.|:.
Zfish   128 MALLHLSSPVTFSNYIQPVCLAADGSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNL 192

  Fly   704 CKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANL 768
            |..::   |....|.:..:|||...||:||||||||||:..||.: .:..||::|:|.|||:.|.
Zfish   193 CNCLY---GGGSSITNNMMCAGLMQGGKDSCQGDSGGPMVIKSFN-TWVQAGVVSFGKGCADPNY 253

  Fly   769 PGVCTRISKFTPWILEHVR 787
            |||..|:|::..||.::||
Zfish   254 PGVYARVSQYQNWISQYVR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 93/244 (38%)
Tryp_SPc 544..785 CDD:238113 95/246 (39%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 93/244 (38%)
Tryp_SPc 38..269 CDD:238113 95/245 (39%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.